Did you know that you can buy products from over 140 different suppliers from us?

GTF2I Repeat Domain Containing 1 (GTF2IRD1) (C-Term) antibody

Details for Product No. ABIN309939
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
BEN, WBS, GTF3, RBAP2, CREAM1, MUSTRD1, WBSCR11, WBSCR12, hMusTRD1alpha1, 1700012P16Rik, Cream1, ESTM9, Gtf2il, MusTRD1, Tg(Alb1-Myc)166.8Sst, X83320, Gtf3, XBEN, XWBSCR11, cream1, gtf3, mustrd1, rbap ... show more
BEN, WBS, GTF3, RBAP2, CREAM1, MUSTRD1, WBSCR11, WBSCR12, hMusTRD1alpha1, 1700012P16Rik, Cream1, ESTM9, Gtf2il, MusTRD1, Tg(Alb1-Myc)166.8Sst, X83320, Gtf3, XBEN, XWBSCR11, cream1, gtf3, mustrd1, rbap2, wbs, wbscr11, wbscr12, GTF2IRD1 show less
Epitope
C-Term
(12), (7), (7), (4), (3), (2), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(51), (12), (12), (4), (1), (1), (1)
Host
Rabbit
(32), (17), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(47), (33), (10), (9), (4), (3), (3), (3)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309939
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GTF2IRD1
Sequence VIINQLQPFAEICNDAKVPAKDSSIPKRKRKRVSEGNSVS SSSSSSSSSS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against GTF2IRD1. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name GTF2IRD1
Background GTF2IRD1 contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. GTF2IRD1 is related to Williams-Beuren syndrome, a multisystem developmental disorder. The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing of this gene generates at least 2 transcript variants.
Molecular Weight 106 kDa
Gene ID 9569
NCBI Accession NM_016328, NP_057412
UniProt Q9UHL9
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 959 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-GTF2I Repeat Domain Containing 1 (GTF2IRD1) (C-Term) antibody anti-GTF2I Repeat Domain Containing 1 (GTF2IRD1) (C-Term) antibody
Background publications Tassabehji, Hammond, Karmiloff-Smith et al.: "GTF2IRD1 in craniofacial development of humans and mice." in: Science (New York, N.Y.), Vol. 310, Issue 5751, pp. 1184-7, 2005 (PubMed).

Hosts (32), (17), (4)
Reactivities (51), (12), (12), (4), (1), (1), (1)
Applications (47), (33), (10), (9), (4), (3), (3), (3)
Conjugates (2), (2), (2), (2), (2), (2)
Epitopes (12), (7), (7), (4), (3), (2), (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309939
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top