Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309957

Zinc Finger Protein 408 (ZNF408) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gm1011
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309957
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF408 antibody: synthetic peptide directed towards the N terminal of human ZNF408
Sequence MEEAEELLLEGKKALQLAREPRLGLDLGWNPSGEGCTQGL KDVPPEPTRD
Predicted Reactivity Human : 100%, Bovine : 90%
Characteristics This is a rabbit polyclonal antibody against ZNF408. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF408
Background ZNF408 may be involved in transcriptional regulation.
Molecular Weight 78kDa
Gene ID 79797
NCBI Accession NP_079017, NM_024741
UniProt Q9H9D4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF408 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 408 (ZNF408)", type "Antibodies"
Hosts (11), (1)
Reactivities (12), (2), (2), (2)
Applications (12), (2), (1)
Epitopes (4), (3), (2), (1), (1), (1), (1)
Beacon