Did you know that you can buy products from over 140 different suppliers from us?

SRY (Sex Determining Region Y)-Box 7 (SOX7) (N-Term) antibody

Details for Product No. ABIN309962
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms sox7-A, xSox7
Epitope
N-Term
(9), (7), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Dog (Canine), Human, Chicken
(36), (18), (17), (13), (12), (12), (1), (1), (1), (1)
Host
Rabbit
(35), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(25), (12), (10), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309962
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SOX7
Sequence DKGSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSK MLGKSWKALT
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 100 % Application WB, IHC
Characteristics This is a rabbit polyclonal antibody against SOX7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SOX7
Background SOX7 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. SOX7 may act as a transcriptional regulator after forming a protein complex with other proteins. It may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.
Molecular Weight 42 kDa
Gene ID 83595
NCBI Accession NM_031439, NP_113627
UniProt Q9BT81
Research Area Lineage Markers, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 388 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SRY (Sex Determining Region Y)-Box 7 (SOX7) (N-Term) antibody anti-SRY (Sex Determining Region Y)-Box 7 (SOX7) (N-Term) antibody
anti-SRY (Sex Determining Region Y)-Box 7 (SOX7) (N-Term) antibody (2) WB Suggested Anti-SOX7
Antibody Titration: 0.2-1 µg/mL ELISA Titer: 1:.2500
Positive Control: Transfected 293T
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Validation Images
back to top