SRY (Sex Determining Region Y)-Box 7 (SOX7) antibody

Antigen: SRY (Sex Determining Region Y)-Box 7 (SOX7)

Synonyms: MGC10895

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis, Chicken, Dog (Canine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN309962

Additional Information

Alternative name: SOX7

Gene ID: SOX7

UniProt: Q9BT81

Immunogen: The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the N terminal of human SOX7

Sequence: DKGSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSK MLGKSWKALT

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SOX7 antibody concentration is 1 mg/ml.

Description: SOX7 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. SOX7 may act as a transcriptional regulator after forming a protein complex with other proteins. It may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.

Characteristics: Antigen Size: 388 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-SOX7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Lineage Markers, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-SOX7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

anti-SRY (Sex Determining Region Y)-Box 7 (SOX7) antibody (Image 2)

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).