Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309978

Zinc Finger Protein 555 (ZNF555) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF14
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309978
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF555 antibody: synthetic peptide directed towards the N terminal of human ZNF555
Sequence DSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFQNLA SVDDETQFKA
Predicted Reactivity Human : 100%, Bovine : 85%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against ZNF555. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF555
Background ZNF555 contains 15 C2H2-type zinc fingers and 1 KRAB domain. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Molecular Weight 73kDa
Gene ID 148254
NCBI Accession NP_690004, NM_152791
UniProt Q8NEP9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF555 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 555 (ZNF555)", type "Antibodies"
Hosts (13)
Reactivities (13), (2)
Applications (13), (3), (2)
Epitopes (5), (5), (2), (1)
Beacon