Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309992

T-Box 20 (TBX20) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASD4, Tbx12, AL022859, 9430010M06Rik, hrt, cb826, ZF-TBX20, tbx20-A, XTBX20, TBX20, tbx20
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309992
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TBX20 antibody: synthetic peptide directed towards the middle region of human TBX20
Sequence MVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDH TASLLNLKSE
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against TBX20. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TBX20
Background TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.
Molecular Weight 50kDa
Gene ID 57057
NCBI Accession NP_001071121, NM_001077653
UniProt Q000T4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TBX20 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kirk, Sunde, Costa et al.: "Mutations in cardiac T-box factor gene TBX20 are associated with diverse cardiac pathologies, including defects of septation and valvulogenesis and cardiomyopathy." in: American journal of human genetics, Vol. 81, Issue 2, pp. 280-91, 2007 (PubMed).

Alternatives for antigen "T-Box 20 (TBX20)", type "Antibodies"
Hosts (7), (1)
Reactivities (8), (4), (1), (1), (1), (1), (1), (1)
Applications (8), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1), (1)
Beacon