Did you know that you can buy products from over 140 different suppliers from us?

T-Box 20 (TBX20) (Middle Region) antibody

Details for Product No. ABIN309992
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASD4, Tbx12, AL022859, 9430010M06Rik, hrt, cb826, ZF-TBX20, tbx20-A, XTBX20, TBX20, tbx20
Epitope
Middle Region
(9), (7), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(14), (3), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (6), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309992
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TBX20
Sequence MVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDH TASLLNLKSE
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against TBX20. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TBX20
Background TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.
Molecular Weight 50 kDa
Gene ID 57057
NCBI Accession NM_001077653, NP_001071121
UniProt Q000T4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 447 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-T-Box 20 (TBX20) (Middle Region) antibody WB Suggested Anti-TBX20 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Kirk, Sunde, Costa et al.: "Mutations in cardiac T-box factor gene TBX20 are associated with diverse cardiac pathologies, including defects of septation and valvulogenesis and cardiomyopathy." in: American journal of human genetics, Vol. 81, Issue 2, pp. 280-91, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309992
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top