Tubulin, beta 2A (TUBB2A) (Middle Region) antibody

Details for Product No. ABIN309995
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms TUBB, TUBB2, dJ40E16.7, Tubb2, M(beta)2, TUBB2A, beta-5, tubb2a, tubb4, tubb5, tbb3
Epitope
Middle Region
(10), (4), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Arabidopsis, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Human
(38), (10), (6), (2), (1), (1), (1), (1)
Host
Rabbit
(29), (10)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(38), (24), (20), (10), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN309995
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TUBB2A
Sequence AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM FDSKNMMAAC
Predicted Reactivity Mouse : 100 %  
Characteristics This is a rabbit polyclonal antibody against TUBB2A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TUBB2A
Background TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Molecular Weight 49 kDa
Gene ID 7280
NCBI Accession NM_001069, NP_001060
UniProt Q13885
Research Area Signaling, Cytoskeleton
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 445 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tubulin, beta 2A (TUBB2A) (Middle Region) antibody WB Suggested Anti-TUBB2A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Frum, Busby, Ramamoorthy et al.: "HDM2-binding partners: interaction with translation elongation factor EF1alpha." in: Journal of proteome research, Vol. 6, Issue 4, pp. 1410-7, 2007 (PubMed).

Hosts (29), (10)
Reactivities (38), (10), (6), (2), (1), (1), (1), (1)
Applications (38), (24), (20), (10), (2), (1), (1), (1), (1)
Epitopes (10), (4), (2), (2), (2), (2), (1), (1), (1)
back to top