Ribosomal Protein L8 (RPL8) (C-Term) antibody

Details for Product No. ABIN310001
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms L8, zgc:73105, zgc:77641, CG1263, Dmel\\CG1263, M(3)62F, M(3)LS2, Rp L8, anon-EST:Posey5, rpL8
Epitope
C-Term
(5), (3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human
(22), (7), (7), (5), (2), (1), (1)
Host
Rabbit
(18), (7), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(25), (17), (6), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310001
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RPL8
Sequence EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLR GTKTVQEKEN
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against RPL8. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name RPL8
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm. In rat, the protein associates with the 5.8S rRNA, very likely participates in the binding of aminoacyl-tRNA, and is a constituent of the elongation factor 2-binding site at the ribosomal subunit interface. Alternatively spliced transcript variants encoding the same protein exist. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 28 kDa
Gene ID 6132
NCBI Accession NM_000973, NP_000964
UniProt P62917
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 257 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein L8 (RPL8) (C-Term) antibody WB Suggested Anti-RPL8 Antibody Titration: 0.3125ug/ml
Positive Control: HepG2 cell lysate
anti-Ribosomal Protein L8 (RPL8) (C-Term) antibody (2) anti-Ribosomal Protein L8 (RPL8) (C-Term) antibody (Image 2)
Background publications Kenmochi, Kawaguchi, Rozen et al.: "A map of 75 human ribosomal protein genes." in: Genome research, Vol. 8, Issue 5, pp. 509-23, 1998 (PubMed).

Hosts (18), (7), (1)
Reactivities (22), (7), (7), (5), (2), (1), (1)
Applications (25), (17), (6), (4), (1), (1)
Conjugates (2), (2), (2)
Epitopes (5), (3), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top