Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310013

RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2010300K22Rik, 2700019M19Rik, AU017537, hermes, RGD1561067, HERMES
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Pubmed 1 reference available
Catalog no. ABIN310013
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RBPMS antibody: synthetic peptide directed towards the N terminal of human RBPMS
Sequence LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALN GIRFDPEIPQ
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%, Horse : 85%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against RBPMS. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name RBPMS
Background RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight 24kDa
Gene ID 11030
NCBI Accession NP_001008712, NM_001008712
UniProt Q569H2
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RBPMS antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "RNA Binding Protein with Multiple Splicing (RBPMS)", type "Antibodies"
Hosts (16), (12)
Reactivities (23), (5), (5), (3), (2), (1), (1), (1)
Applications (28), (7), (6), (4), (4), (3), (2)
Epitopes (5), (2), (2), (2), (1), (1), (1), (1)
Beacon