Did you know that you can buy products from over 140 different suppliers from us?

RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody

Details for Product No. ABIN310013
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2010300K22Rik, 2700019M19Rik, AU017537, hermes, HERMES, RGD1561067
Epitope
N-Term
(5), (3), (3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(27), (6), (6), (2), (2), (1), (1), (1)
Host
Rabbit
(18), (13)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB), Immunocytochemistry (ICC)
(31), (6), (6), (5), (5), (3), (3), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310013
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RBPMS
Sequence LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALN GIRFDPEIPQ
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %, Horse : 80 %, Guinea pig : 70 %
Characteristics This is a rabbit polyclonal antibody against RBPMS. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name RBPMS
Background RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight 24 kDa
Gene ID 11030
NCBI Accession NM_001008712, NP_001008712
UniProt Q569H2
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 219 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody anti-RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody
anti-RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody (2) anti-RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody (Image 2)
anti-RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody (3) Mouse RetinaFixation of the tissues with 4 % paraformaldehyde in 0.1M PO4, and performed typical procedures of immunocytochemistry. Blocking solution was 0.4 % triton X-100 + 4 % normal donkey serum in PBS. RBPMS Antibody was incubated in blocking solution with 1:200 dilution (4 degree, overnight). Secondary Antibody was Cy3-conjugated.
anti-RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody (4) WB Suggested Anti-RBPMS
Antibody Titration: 0.5 µg/mL
Positive Control: Human Liver
anti-RNA Binding Protein with Multiple Splicing (RBPMS) (N-Term) antibody (5) WB Suggested Anti-RBPMS AntibodyTitration: 0.5 µg/mL
Positive Control: Liver
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Validation Images
back to top