Poly(rC) Binding Protein 1 (PCBP1) (Middle Region) antibody

Details for Product No. ABIN310056
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HNRPX, HNRPE1, hnRNP-X, hnRNP-E1, WBP17, [a]CP-1, alphaCP-1, RGD1561319, hnRNP E1, PCBP1
Epitope
Middle Region
(7), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Human
(21), (6), (6), (3), (2), (1), (1)
Host
Rabbit
(12), (7), (4)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(23), (15), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN310056
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1
Sequence PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSH FAMMHGGTGF
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 % Application WB
Characteristics This is a rabbit polyclonal antibody against PCBP1. It was validated on Western Blot.
Purification Affinity Purified
Alternative Name PCBP1
Background PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. PCBP1 is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.This intronless gene is thought to be generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. Additional Information IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Molecular Weight 37 kDa
Gene ID 5093
NCBI Accession NM_006196, NP_006187
UniProt Q15365
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 356 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly(rC) Binding Protein 1 (PCBP1) (Middle Region) antibody anti-Poly(rC) Binding Protein 1 (PCBP1) (Middle Region) antibody
anti-Poly(rC) Binding Protein 1 (PCBP1) (Middle Region) antibody (2) anti-Poly(rC) Binding Protein 1 (PCBP1) (Middle Region) antibody (Image 2)
anti-Poly(rC) Binding Protein 1 (PCBP1) (Middle Region) antibody (3) anti-Poly(rC) Binding Protein 1 (PCBP1) (Middle Region) antibody (Image 3)
Product cited in: Shi, Bencze, Stemmler et al.: "A cytosolic iron chaperone that delivers iron to ferritin." in: Science (New York, N.Y.), Vol. 320, Issue 5880, pp. 1207-10, 2008 (PubMed).

Hosts (12), (7), (4)
Reactivities (21), (6), (6), (3), (2), (1), (1)
Applications (23), (15), (4), (3), (2)
Epitopes (7), (2), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top