Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310056

Poly(rC) Binding Protein 1 (PCBP1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HNRPX, HNRPE1, hnRNP-X, hnRNP-E1, WBP17, [a]CP-1, alphaCP-1, RGD1561319, hnRNP E1, PCBP1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310056
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1
Sequence PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSH FAMMHGGTGF
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100% Application WB
Characteristics This is a rabbit polyclonal antibody against PCBP1. It was validated on Western Blot. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name PCBP1
Background PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. PCBP1 is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.This intronless gene is thought to be generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. Additional Information IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Molecular Weight 37kDa
Gene ID 5093
NCBI Accession NP_006187, NM_006196
UniProt Q15365
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final Anti-PCBP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Shi, Bencze, Stemmler et al.: "A cytosolic iron chaperone that delivers iron to ferritin." in: Science (New York, N.Y.), Vol. 320, Issue 5880, pp. 1207-10, 2008 (PubMed).

Alternatives for antigen "Poly(rC) Binding Protein 1 (PCBP1)", type "Antibodies"
Hosts (11), (7), (3)
Reactivities (19), (6), (6), (3), (2), (1), (1)
Applications (21), (14), (3), (3), (2)
Epitopes (8), (3), (2), (2), (2), (1), (1), (1)
Beacon