Did you know that you can buy products from over 140 different suppliers from us?

serine/arginine-Rich Splicing Factor 6 (SRSF6) (Middle Region) antibody

Details for Product No. ABIN310057
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms b52, sfrs6, srp55, SFRS6, B52, SRP55, 1210001E11Rik, AI314910, AW146126, Sfrs6, sfrs6b, wu:faa54g02, wu:fc17h09, zgc:103497
Epitope
Middle Region
(3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(11), (3), (3)
Host
Rabbit
(7), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (9), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310057
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SFRS6
Sequence KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDK PRTSHRRSYS
Predicted Reactivity Zebrafish : 78 %  
Characteristics This is a rabbit polyclonal antibody against SFRS6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SFRS6
Background SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.
Molecular Weight 39 kDa
Gene ID 6431
NCBI Accession NM_006275, NP_006266
UniProt Q13247
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 344 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-serine/arginine-Rich Splicing Factor 6 (SRSF6) (Middle Region) antibody WB Suggested Anti-SFRS6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top