Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310057

serine/arginine-Rich Splicing Factor 6 (SRSF6) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1210001E11Rik, AI314910, AW146126, Sfrs6, sfrs6, sfrs6b, wu:faa54g02, wu:fc17h09, zgc:103497, b52, srp55, SFRS6, B52, SRP55
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310057
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SFRS6 antibody: synthetic peptide directed towards the middle region of human SFRS6
Sequence KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDK PRTSHRRSYS
Predicted Reactivity Zebrafish : 78%  
Characteristics This is a rabbit polyclonal antibody against SFRS6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SFRS6
Background SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.
Molecular Weight 39kDa
Gene ID 6431
NCBI Accession NP_006266, NM_006275
UniProt Q13247
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SFRS6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "serine/arginine-Rich Splicing Factor 6 (SRSF6)", type "Antibodies"
Hosts (5), (5)
Reactivities (9), (2), (2)
Applications (9), (9), (2)
Epitopes (3), (1)
Beacon