Did you know that you can buy products from over 140 different suppliers from us?

NOP2/Sun Domain Family, Member 6 (NSUN6) (N-Term) antibody

Details for Product No. ABIN310123
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933414E04Rik, NOPD1, 4933403D21Rik, Nopd1
Epitope
N-Term
(3), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(6), (1), (1), (1), (1)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310123
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NSUN6
Sequence SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFET LLKHLSHPPS
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Bovine : 90 %, Pig : 90 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against NSUN6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NSUN6
Background NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.
Molecular Weight 52 kDa
Gene ID 221078
NCBI Accession NM_182543, NP_872349
UniProt Q8TEA1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 469 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Hosts (8)
Reactivities (6), (1), (1), (1), (1)
Applications (8), (2), (1)
Epitopes (3), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310123
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top