Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310147

Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CPE1, CYP2E, P450-J, P450C2E, Cyp2e, CYP2E1, CYPIIE1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310147
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1
Sequence QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGE GLARMELFLL
Predicted Reactivity Human : 100%, Guinea pig : 85%, Mouse : 85%, Rat : 85%, Bovine : 78%, Horse : 78%, Pig : 78%, Sheep : 78%
Characteristics This is a rabbit polyclonal antibody against CYP2E1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CYP2E1
Background CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.
Molecular Weight 54kDa
Gene ID 1571
NCBI Accession NP_000764, NM_000773
UniProt P05181
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CYP2E1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dey, Kessova, Cederbaum: "Decreased protein and mRNA expression of ER stress proteins GRP78 and GRP94 in HepG2 cells over-expressing CYP2E1." in: Archives of biochemistry and biophysics, Vol. 447, Issue 2, pp. 155-66, 2006 (PubMed).

Alternatives for antigen "Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1)", type "Antibodies"
Hosts (85), (11), (6)
Reactivities (79), (53), (45), (27), (24), (24), (2)
Applications (73), (36), (28), (27), (20), (11), (8), (6), (5), (4), (3), (2), (2), (1)
Conjugates (8), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (17), (3), (3), (2), (2), (2), (2), (1), (1)
Beacon