Did you know that you can buy products from over 140 different suppliers from us?

Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1) (C-Term) antibody

Details for Product No. ABIN310147
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CYP2E1, CYP2E, CYPIIE1, CPE1, P450-J, P450C2E, Cyp2e
Epitope
C-Term
(18), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Human, Chicken
(82), (57), (48), (26), (24), (24), (2)
Host
Rabbit
(89), (11), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(7), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(77), (35), (30), (27), (20), (15), (12), (11), (4), (4), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310147
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CYP2E1
Sequence QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGE GLARMELFLL
Predicted Reactivity Human : 100 %, Guinea pig : 80 %, Mouse : 80 %, Rat : 80 %, Bovine : 70 %, Horse : 70 %, Pig : 70 %, Sheep : 70 %
Characteristics This is a rabbit polyclonal antibody against CYP2E1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CYP2E1
Background CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.
Molecular Weight 54 kDa
Gene ID 1571
NCBI Accession NM_000773, NP_000764
UniProt P05181
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 493 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Dey, Kessova, Cederbaum: "Decreased protein and mRNA expression of ER stress proteins GRP78 and GRP94 in HepG2 cells over-expressing CYP2E1." in: Archives of biochemistry and biophysics, Vol. 447, Issue 2, pp. 155-66, 2006 (PubMed).

Validation Images
back to top