Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310149

Claudin 18 (CLDN18) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SFTA5, SFTPJ, claudin-18, CLDN18
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310149
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18
Sequence PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI YDGGARTEDE
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 92%, Dog : 78%  
Characteristics This is a rabbit polyclonal antibody against CLDN18. It was validated on Western Blot. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name CLDN18
Background CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001).
Molecular Weight 28kDa
Gene ID 51208
NCBI Accession NP_001002026, NM_001002026
UniProt P56856
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CLDN18 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Claudin 18 (CLDN18)", type "Antibodies"
Hosts (16), (1)
Reactivities (13), (5), (4), (1), (1), (1)
Applications (17), (6), (4), (3), (2), (1), (1), (1)
Epitopes (6), (2), (2), (2), (2), (1)
Beacon