Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310177

Formiminotransferase Cyclodeaminase (FTCD) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms wu:fp37b11, zgc:63647, LCHC1, FTCD
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN310177
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FTCD antibody: synthetic peptide directed towards the N terminal of human FTCD
Sequence FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYT FVGPPECVVE
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Pig : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against FTCD. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name FTCD
Background FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.
Molecular Weight 60kDa
Gene ID 10841
NCBI Accession NP_006648, NM_006657
UniProt O95954
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FTCD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Vermeire, Brokx, Van de Heyning et al.: "Bilateral cochlear implantation in children." in: International journal of pediatric otorhinolaryngology, Vol. 67, Issue 1, pp. 67-70, 2003 (PubMed).

Background publications Hilton, Christensen, Watkins et al.: "The molecular basis of glutamate formiminotransferase deficiency." in: Human mutation, Vol. 22, Issue 1, pp. 67-73, 2003 (PubMed).

Alternatives for antigen "Formiminotransferase Cyclodeaminase (FTCD)", type "Antibodies"
Hosts (11), (7), (5)
Reactivities (20), (3), (3), (3), (1), (1), (1)
Applications (23), (9), (6), (6), (3), (1), (1)
Epitopes (5), (3), (1)
Beacon