Did you know that you can buy products from over 140 different suppliers from us?

Formiminotransferase Cyclodeaminase (FTCD) (N-Term) antibody

Details for Product No. ABIN310177
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms wu:fp37b11, zgc:63647, LCHC1, FTCD
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
(14), (3), (3), (2), (1), (1), (1)
Host
Rabbit
(9), (4), (3)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(16), (5), (3), (2), (1), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310177
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FTCD
Sequence FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYT FVGPPECVVE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Pig : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against FTCD. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name FTCD
Background FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.
Molecular Weight 60 kDa
Gene ID 10841
NCBI Accession NM_006657, NP_006648
UniProt O95954
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 541 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Formiminotransferase Cyclodeaminase (FTCD) (N-Term) antibody anti-Formiminotransferase Cyclodeaminase (FTCD) (N-Term) antibody
anti-Formiminotransferase Cyclodeaminase (FTCD) (N-Term) antibody (2) anti-Formiminotransferase Cyclodeaminase (FTCD) (N-Term) antibody (Image 2)
Product cited in: Vermeire, Brokx, Van de Heyning et al.: "Bilateral cochlear implantation in children." in: International journal of pediatric otorhinolaryngology, Vol. 67, Issue 1, pp. 67-70, 2003 (PubMed).

Background publications Hilton, Christensen, Watkins et al.: "The molecular basis of glutamate formiminotransferase deficiency." in: Human mutation, Vol. 22, Issue 1, pp. 67-73, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310177
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top