Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310203

Lecithin-Cholesterol Acyltransferase (LCAT) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI046659, D8Wsu61e, MGC82035, lcat, MGC88964, LCAT
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310203
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LCAT antibody: synthetic peptide directed towards the N terminal of human LCAT
Sequence MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKA ELSNHTRPVI
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%
Characteristics This is a rabbit polyclonal antibody against LCAT. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name LCAT
Background LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.
Molecular Weight 48kDa
Gene ID 3931
NCBI Accession NP_000220, NM_000229
UniProt P04180
Research Area Cancer, Atherosclerosis, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LCAT antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Calabresi, Pisciotta, Costantin et al.: "The molecular basis of lecithin:cholesterol acyltransferase deficiency syndromes: a comprehensive study of molecular and biochemical findings in 13 unrelated Italian families." in: Arteriosclerosis, thrombosis, and vascular biology, Vol. 25, Issue 9, pp. 1972-8, 2005 (PubMed).

Alternatives for antigen "Lecithin-Cholesterol Acyltransferase (LCAT)", type "Antibodies"
Hosts (52), (2)
Reactivities (43), (21), (20), (13), (12), (12)
Applications (43), (24), (11), (10), (10), (8), (6), (5), (5), (1), (1), (1), (1)
Conjugates (7), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon