Lecithin-Cholesterol Acyltransferase (LCAT) (N-Term) antibody

Details for Product No. ABIN310203
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI046659, D8Wsu61e, MGC82035, lcat, MGC88964, LCAT
Epitope
N-Term
(6), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
(43), (24), (23), (13), (12), (12)
Host
Rabbit
(52), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(7), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(46), (25), (14), (10), (10), (10), (9), (6), (4), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310203
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human LCAT
Sequence MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKA ELSNHTRPVI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 100 %
Characteristics This is a rabbit polyclonal antibody against LCAT. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name LCAT
Background LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.
Molecular Weight 48 kDa
Gene ID 3931
NCBI Accession NM_000229, NP_000220
UniProt P04180
Research Area Cancer, Atherosclerosis, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 440 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lecithin-Cholesterol Acyltransferase (LCAT) (N-Term) antibody WB Suggested Anti-LCAT Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
Background publications Calabresi, Pisciotta, Costantin et al.: "The molecular basis of lecithin:cholesterol acyltransferase deficiency syndromes: a comprehensive study of molecular and biochemical findings in 13 unrelated Italian families." in: Arteriosclerosis, thrombosis, and vascular biology, Vol. 25, Issue 9, pp. 1972-8, 2005 (PubMed).

Hosts (52), (4)
Reactivities (43), (24), (23), (13), (12), (12)
Applications (46), (25), (14), (10), (10), (10), (9), (6), (4), (1), (1), (1)
Conjugates (7), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top