Steroid Sulfatase (Microsomal), Isozyme S (STS) (C-Term) antibody

Details for Product No. ABIN310209
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ES, ASC, XLI, ARSC, SSDD, ARSC1, ArsC, abcg2
Epitope
C-Term
(4), (4), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
(32), (15), (14), (13), (13), (13)
Host
Rabbit
(25), (5), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (10), (10), (4), (4), (4), (2), (1)
Pubmed 2 references available
Catalog no. ABIN310209
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human STS
Sequence LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQT LPEVPDQFSW
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Pig : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against STS. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name STS
Background STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).
Molecular Weight 64 kDa
Gene ID 412
NCBI Accession NM_000351, NP_000342
UniProt P08842
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 583 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (25), (5), (4)
Reactivities (32), (15), (14), (13), (13), (13)
Applications (24), (10), (10), (4), (4), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (1), (1), (1), (1), (1)
back to top