Did you know that you can buy products from over 140 different suppliers from us?

Keratin 17 (KRT17) (C-Term) antibody

Details for Product No. ABIN310213
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PC, K17, PC2, PCHC1, Krt1-17, Ka17, si:dkeyp-113d7.7, KRT17, krt16
Epitope
C-Term
(31), (12), (10), (6), (4), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(146), (75), (53), (12), (12)
Host
Rabbit
(92), (69), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(6), (6), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(125), (77), (55), (53), (34), (31), (30), (20), (13), (5), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310213
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KRT17
Sequence IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV ISSREQVHQT
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against KRT17. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name KRT17
Background KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.
Molecular Weight 48 kDa
Gene ID 3872
NCBI Accession NM_000422, NP_000413
UniProt Q04695
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 432 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Keratin 17 (KRT17) (C-Term) antibody WB Suggested Anti-KRT17 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-Keratin 17 (KRT17) (C-Term) antibody (2) anti-Keratin 17 (KRT17) (C-Term) antibody (Image 2)
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310213
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top