Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310213

Keratin 17 (KRT17) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PC, K17, PC2, PCHC1, Krt1-17, Ka17, si:dkeyp-113d7.7, KRT17, krt16
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310213
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KRT17 antibody: synthetic peptide directed towards the C terminal of human KRT17
Sequence IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV ISSREQVHQT
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against KRT17. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name KRT17
Background KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.
Molecular Weight 48kDa
Gene ID 3872
NCBI Accession NP_000413, NM_000422
UniProt Q04695
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KRT17 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Keratin 17 (KRT17)", type "Antibodies"
Hosts (81), (65), (4)
Reactivities (130), (71), (47), (12), (12)
Applications (107), (82), (42), (37), (25), (23), (22), (20), (12), (11), (7), (6), (2), (1)
Conjugates (6), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (15), (12), (4), (4), (2), (1)
Beacon