Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310261

Alkaline Phosphatase, Placental (ALP) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALP, PALP, PLAP, PLAP-1, Akp2, alp, zgc:56672, DDBDRAFT_0205491, DDBDRAFT_0231570, DDB_0205491, DDB_0231570, ECK0378, JW0374, psiA, iap, alpl
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN310261
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP
Sequence TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLD EETHAGEDVA
Predicted Reactivity Human :100%,   African clawed frog :85%,   Dog :85%,   Western clawed frog :85%,   Green puffer :85%,   Yellowfever mosquito :84%,   Shewanella baltica BA175 :84%,   Shewanella baltica OS183 :84%,   Shewanella baltica OS678 :84%,   Shewanella benthica KT99 :84%,   Pseudoalteromonas tunicata D2 :84%,   Alteromonadales bacterium TW-7 :84%,   Sea squirt :78%,   Chicken :78%,   Zebrafish :78%,   Mouse :78%,   Atlantic cod :78%,   Rat :78%,   Silk moth :78%,   Wild silk moth :78%,   Bovine :78%,   Florida lancelet :78%,   Savannah tsetse fly :78%,   Congregibacter litoralis KT71 :76%,   Black-legged tick :76%,   Red flour beetle :76%,   Gamma proteobacterium HTCC2207 :76%,   Fruit fly :76%,   Encephalitis mosquito :75%,  
Characteristics This is a rabbit polyclonal antibody against ALPP. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name ALPP
Background There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form. The coding sequence for this form of alkaline phosphatase is unique in that the 3' untranslated region contains multiple copies of an Alu family repeat. In addition, this gene is polymorphic and three common alleles (type 1, type 2 and type 3) for this form of alkaline phosphatase have been well characterized.
Molecular Weight 59kDa
Gene ID 250
NCBI Accession NP_001623, NM_001632
UniProt P05187
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALPP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Alkaline Phosphatase, Placental (ALP)", type "Antibodies"
Hosts (75), (48), (3)
Reactivities (124), (9), (9), (1)
Applications (66), (56), (51), (26), (21), (10), (9), (7), (4), (4), (4), (2), (1), (1), (1), (1)
Conjugates (3), (3)
Epitopes (10), (6), (4), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon