Did you know that you can buy products from over 140 different suppliers from us?

CES2 (C-Term) antibody

Details for Product No. ABIN310292
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CE-2, CES2A1, PCE-2, iCE, Ces2, ces2A3, EG436059, Gm5744
Epitope
C-Term
(9), (9), (7), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(50), (5), (4), (3)
Host
Rabbit
(38), (17), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(57), (33), (23), (9), (9), (6), (4), (4), (2)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310292
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CES2
Sequence HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKI QELEEPEERH
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against CES2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined, however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined, however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Weight 69 kDa
Gene ID 8824
NCBI Accession NM_003869, NP_003860
UniProt O00748
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 623 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-CES2 (C-Term) antibody WB Suggested Anti-CES2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
back to top