Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310361

Chromosome 21 Open Reading Frame 7 (C21orf7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf7, HC21ORF7, TAK1L, TAKL, TAKL-1, TAKL-2, TAKL-4, C1H21orf7, ORF63, Tak1l
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310361
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C21orf7 antibody: synthetic peptide directed towards the C terminal of human C21orf7
Sequence DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKL DQAEKEKVDA
Predicted Reactivity Guinea pig : 100%, Human : 100%, Horse : 92%, Chicken : 76%
Characteristics This is a rabbit polyclonal antibody against C21orf7. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name C21orf7
Background C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.
Molecular Weight 27kDa
Gene ID 56911
NCBI Accession NP_064537, NM_020152
UniProt P57077
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C21orf7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Chromosome 21 Open Reading Frame 7 (C21orf7)", type "Antibodies"
Hosts (5), (2)
Reactivities (6)
Applications (7), (2), (2), (1), (1)
Epitopes (4), (3), (1)
Beacon