Chromosome 21 Open Reading Frame 7 (C21orf7) (C-Term) antibody

Details for Product No. ABIN310361
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C21orf7, HC21ORF7, TAK1L, TAKL, TAKL-1, TAKL-2, TAKL-4, C1H21orf7, ORF63, Tak1l
Epitope
C-Term
(2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(4)
Host
Rabbit
(4), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(5), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310361
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human C21orf7
Sequence DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKL DQAEKEKVDA
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Horse : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against C21orf7. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name C21orf7
Background C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.
Molecular Weight 27 kDa
Gene ID 56911
NCBI Accession NM_020152, NP_064537
UniProt P57077
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 242 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 21 Open Reading Frame 7 (C21orf7) (C-Term) antibody WB Suggested Anti-C21orf7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-Chromosome 21 Open Reading Frame 7 (C21orf7) (C-Term) antibody (2) anti-Chromosome 21 Open Reading Frame 7 (C21orf7) (C-Term) antibody (Image 2)
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Hosts (4), (1)
Reactivities (4)
Applications (5), (2), (1), (1)
Epitopes (2), (2), (1)
back to top