Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310365

DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. Cerevisiae) (DCUN1D1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DCNL1, DCUN1L1, RP42, SCCRO, SCRO, Tes3, Rp42, pTes3, dcun1l1, rp42, sccro, scro, tes3, fd19a01, zgc:66414, wu:fd19a01
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310365
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DCUN1D1 antibody: synthetic peptide directed towards the N terminal of human DCUN1D1
Sequence SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN RYKDPQDENK
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against DCUN1D1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name DCUN1D1
Background DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Molecular Weight 28kDa
Gene ID 54165
NCBI Accession NP_065691, NM_020640
UniProt Q96GG9
Research Area Cancer, Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DCUN1D1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kurz, Ozlü, Rudolf et al.: "The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae." in: Nature, Vol. 435, Issue 7046, pp. 1257-61, 2005 (PubMed).

Alternatives for antigen "DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. Cerevisiae) (DCUN1D1)", type "Antibodies"
Hosts (23), (8), (3)
Reactivities (32), (20), (16), (14), (13), (13), (1), (1), (1), (1), (1), (1), (1)
Applications (23), (15), (10), (4), (4), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (3), (1), (1), (1), (1)
Beacon