Did you know that you can buy products from over 140 different suppliers from us?

DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. Cerevisiae) (DCUN1D1) (N-Term) antibody

Details for Product No. ABIN310365
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DCNL1, DCUN1L1, RP42, SCCRO, SCRO, Tes3, Rp42, pTes3, dcun1l1, rp42, sccro, scro, tes3, fd19a01, zgc:66414, wu:fd19a01
Epitope
N-Term
(7), (3), (3), (3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Chicken
(39), (19), (16), (13), (12), (12)
Host
Rabbit
(24), (14), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(30), (19), (10), (7), (4), (4), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310365
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DCUN1D1
Sequence SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN RYKDPQDENK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against DCUN1D1. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name DCUN1D1
Background DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Molecular Weight 28 kDa
Gene ID 54165
NCBI Accession NM_020640, NP_065691
UniProt Q96GG9
Research Area Cancer, Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 259 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. Cerevisiae) (DCUN1D1) (N-Term) antibody WB Suggested Anti-DCUN1D1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Kurz, Ozlü, Rudolf et al.: "The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae." in: Nature, Vol. 435, Issue 7046, pp. 1257-61, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310365
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top