Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) (N-Term) antibody

Details for Product No. ABIN310472
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms sialin, SP55, AL022787, FABP-pm, Got-2, mAspAT, KAT4, KATIV, mitAAT, ASPATA, got2, zgc:66329, AST, ISSD, NSD, SD, SIALIN, SIASD, SLD, 4631416G20Rik, 4732491M05
Epitope
N-Term
(8), (6), (4), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human, Zebrafish (Danio rerio)
(77), (38), (35), (18), (13), (13), (7), (1), (1), (1)
Host
Rabbit
(51), (20), (12), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(7), (5), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(77), (52), (17), (15), (14), (10), (10), (4), (4), (3)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310472
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GOT2
Sequence PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPS VRKAEAQIAA
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Human : 100 %, Zebrafish : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against GOT2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name GOT2
Background Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Molecular Weight 45 kDa
Gene ID 2806
NCBI Accession NM_002080, NP_002071
UniProt P00505
Research Area Cancer, Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 430 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) (N-Term) antibody WB Suggested Anti-GOT2 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
anti-Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) (N-Term) antibody (2) WB Suggested Anti-GOT2
Antibody Titration: 1.0 µg/mL ELISA Titer: 1:312500
Positive Control: 193T cell lysate
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Validation Images
back to top