Interferon Regulatory Factor 6 (IRF6) (C-Term) antibody

Details for Product No. ABIN310490
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LPS, OFC6, PIT, PPS, PPS1, VWS, VWS1, mirf6, AI876454, E230028I05Rik, zgc:63500, xIRF-6, IRF6, lps, pit, pps, vws, ofc6, DKFZp469E012
Epitope
C-Term
(6), (3), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human, Zebrafish (Danio rerio), Chicken
(50), (22), (17), (5), (4), (4), (3), (3), (3), (1), (1), (1)
Host
Rabbit
(32), (13), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(41), (15), (11), (10), (10), (8), (5), (4), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN310490
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human IRF6
Sequence FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLI LVQVIPVVAR
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against IRF6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name IRF6
Background IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.
Molecular Weight 65 kDa
Gene ID 3664
NCBI Accession NM_004661, NP_006138
UniProt O14896
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Innate Immunity, Cytokines
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 591 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Interferon Regulatory Factor 6 (IRF6) (C-Term) antibody WB Suggested Anti-IRF6 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Hosts (32), (13), (9)
Reactivities (50), (22), (17), (5), (4), (4), (3), (3), (3), (1), (1), (1)
Applications (41), (15), (11), (10), (10), (8), (5), (4), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (3), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top