Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) antibody

Antigen: Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4)

Synonyms: AI853530, MGC27672, SLC7A4, MGC83777, MGC147458, MGC162111, si:dz266f07.3, si:busm1-266f07.3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN310516

Additional Information

Alternative name: SLC7A4 / CAT4

Gene ID: SLC7A4

Immunogen: The immunogen for anti-SLC7A4 antibody: synthetic peptide directed towards the middle region of human SLC7A4

Sequence: GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFI VAAGSICAMN

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SLC7A4 antibody concentration is 1 mg/ml.

Description: SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).

Characteristics: Antigen Size: 635 amino acids

Molecular Weight: 68kDa

Application Details

Application Notes: WB Suggested Anti-SLC7A4 Antibody Titration: 0.125ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SLC7A4 Antibody Titration: 0.125ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).