Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310524

Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AST, ISSD, NSD, SD, SIALIN, SIASD, SLD, got2, zgc:66329, 4631416G20Rik, 4732491M05, sialin, SP55
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310524
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC17A5 antibody: synthetic peptide directed towards the N terminal of human SLC17A5
Sequence LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWA PPLERSKLLS
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against SLC17A5. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SLC17A5
Background SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.This gene encodes a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in this gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.
Molecular Weight 55kDa
Gene ID 26503
NCBI Accession NP_036566, NM_012434
UniProt Q9NRA2
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC17A5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Myall, Wreden, Wlizla et al.: "G328E and G409E sialin missense mutations similarly impair transport activity, but differentially affect trafficking." in: Molecular genetics and metabolism, Vol. 92, Issue 4, pp. 371-4, 2007 (PubMed).

Alternatives for antigen "Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2)", type "Antibodies"
Hosts (48), (17), (14), (10)
Reactivities (70), (37), (35), (24), (14), (13), (6), (2), (1), (1), (1)
Applications (76), (54), (18), (18), (15), (10), (10), (7), (4), (3), (3), (1), (1)
Conjugates (8), (5), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Beacon