Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310565

Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHMD, FOLT, IFC1, REFC, RFC1, LOC100226745
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310565
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC19A1 antibody: synthetic peptide directed towards the N terminal of human SLC19A1
Sequence MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQ IRPGESFITP
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SLC19A1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name SLC19A1
Background Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.
Molecular Weight 65kDa
Gene ID 6573
NCBI Accession NP_919231, NM_194255
UniProt P41440
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC19A1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Payton, Liu, Ge et al.: "Transcriptional regulation of the human reduced folate carrier A1/A2 promoter: Identification of critical roles for the USF and GATA families of transcription factors." in: Biochimica et biophysica acta, Vol. 1731, Issue 2, pp. 115-24, 2005 (PubMed).

Alternatives for antigen "Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1)", type "Antibodies"
Hosts (4), (2)
Reactivities (2), (2), (2)
Applications (4), (3), (2), (1)
Epitopes (5)
Beacon