Did you know that you can buy products from over 140 different suppliers from us?

Tyrosinase-Related Protein 1 (TYRP1) (N-Term) antibody

Details for Product No. ABIN310589
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAS2, CATB, GP75, OCA3, TRP, TRP1, TYRP, b-PROTEIN, B, TRP-1, Tyrp, b, brown, isa, tyrp1, Trrp1, hm:zeh0659, zgc:100893, TYRP1, tyrp-1
Epitope
N-Term
(7), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human, Chicken
(46), (15), (13), (13), (2), (1), (1), (1), (1), (1)
Host
Rabbit
(36), (16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(36), (11), (10), (9), (8), (5), (3), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310589
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TYRP1
Sequence AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVW THYYSVKKTF
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Goat : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Sheep : 100 %, Guinea pig : 90 %, Rat : 90 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against TYRP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TYRP1
Background TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.
Molecular Weight 59 kDa
Gene ID 7306
NCBI Accession NM_000550, NP_000541
UniProt P17643
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 537 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tyrosinase-Related Protein 1 (TYRP1) (N-Term) antibody WB Suggested Anti-TYRP1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Background publications Forshew, Khaliq, Tee et al.: "Identification of novel TYR and TYRP1 mutations in oculocutaneous albinism." in: Clinical genetics, Vol. 68, Issue 2, pp. 182-4, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310589
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top