Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310589

Tyrosinase-Related Protein 1 (TYRP1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAS2, CATB, GP75, OCA3, TRP, TRP1, TYRP, b-PROTEIN, B, TRP-1, Tyrp, b, brown, isa, tyrp1, Trrp1, hm:zeh0659, zgc:100893, TYRP1, tyrp-1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310589
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1
Sequence AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVW THYYSVKKTF
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Goat : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Sheep : 100%, Guinea pig : 92%, Rat : 92%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against TYRP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name TYRP1
Background TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.
Molecular Weight 59kDa
Gene ID 7306
NCBI Accession NP_000541, NM_000550
UniProt P17643
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TYRP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Forshew, Khaliq, Tee et al.: "Identification of novel TYR and TYRP1 mutations in oculocutaneous albinism." in: Clinical genetics, Vol. 68, Issue 2, pp. 182-4, 2005 (PubMed).

Alternatives for antigen "Tyrosinase-Related Protein 1 (TYRP1)", type "Antibodies"
Hosts (30), (19)
Reactivities (43), (15), (13), (13), (2), (1), (1), (1), (1), (1)
Applications (32), (11), (10), (8), (7), (4), (4), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon