Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310595

Zinc Finger, DHHC-Type Containing 13 (ZDHHC13) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HIP14L, HIP3RP, wu:fb06e01, wu:fc39g10, wu:fi22e09, zgc:101690, 2410004E01Rik, C530010M18, Hip14l, kojak, skc4, ZDHHC13
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310595
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZDHHC13 antibody: synthetic peptide directed towards the N terminal of human ZDHHC13
Sequence MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLIS KGQSVNMTDV
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Dog : 92%, Horse : 92%, Rabbit : 92%, Chicken : 91%, Bovine : 85%
Characteristics This is a rabbit polyclonal antibody against ZDHHC13. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name ZDHHC13
Background ZDHHC13 may be involved in the NF-kappa-B signaling pathway.
Molecular Weight 54kDa
Gene ID 54503
NCBI Accession NP_001001483, NM_001001483
UniProt Q8IUH4-3
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZDHHC13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Alternatives for antigen "Zinc Finger, DHHC-Type Containing 13 (ZDHHC13)", type "Antibodies"
Hosts (8), (4), (1)
Reactivities (11), (1), (1)
Applications (12), (4), (2), (1)
Epitopes (5), (3), (2), (2), (1)
Beacon