Podoplanin (PDPN) (N-Term) antibody

Details for Product No. ABIN310607
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms T1A, GP36, GP40, Gp38, OTS8, T1A-2, AGGRUS, HT1A-1, PA2.26, OTS-8, RANDAM-2, T1-alpha, T1a, T1alpha, E11, RTI40, PDPN
Epitope
N-Term
(9), (6), (6), (5), (4), (2), (1), (1)
Reactivity
Human
(111), (46), (23), (2), (1)
Host
Rabbit
(73), (57), (13), (12), (5), (4), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(9), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(101), (50), (47), (38), (37), (28), (27), (20), (19), (15), (7), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310607
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PDPN
Sequence EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRY KSGLTTLVAT
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against PDPN. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name PDPN
Background PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight 25 kDa
Gene ID 10630
NCBI Accession NM_006474, NP_006465
Research Area Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 238 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Podoplanin (PDPN) (N-Term) antibody WB Suggested Anti-PDPN Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Wicki, Lehembre, Wick et al.: "Tumor invasion in the absence of epithelial-mesenchymal transition: podoplanin-mediated remodeling of the actin cytoskeleton." in: Cancer cell, Vol. 9, Issue 4, pp. 261-72, 2006 (PubMed).

Hosts (73), (57), (13), (12), (5), (4), (1)
Reactivities (111), (46), (23), (2), (1)
Applications (101), (50), (47), (38), (37), (28), (27), (20), (19), (15), (7), (3), (1), (1)
Conjugates (9), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Epitopes (9), (6), (6), (5), (4), (2), (1), (1)
back to top