Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310607

Podoplanin (PDPN) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms T1A, GP36, GP40, Gp38, OTS8, T1A-2, AGGRUS, HT1A-1, PA2.26, OTS-8, RANDAM-2, T1-alpha, T1a, T1alpha, E11, RTI40, PDPN
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310607
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PDPN antibody: synthetic peptide directed towards the N terminal of human PDPN
Sequence EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRY KSGLTTLVAT
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against PDPN. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name PDPN
Background PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight 25kDa
Gene ID 10630
NCBI Accession NP_006465, NM_006474
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PDPN antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wicki, Lehembre, Wick et al.: "Tumor invasion in the absence of epithelial-mesenchymal transition: podoplanin-mediated remodeling of the actin cytoskeleton." in: Cancer cell, Vol. 9, Issue 4, pp. 261-72, 2006 (PubMed).

Alternatives for antigen "Podoplanin (PDPN)", type "Antibodies"
Hosts (66), (54), (15), (13), (5), (4), (1)
Reactivities (111), (43), (19), (2)
Applications (92), (51), (44), (34), (34), (28), (21), (20), (15), (11), (6), (3), (1), (1)
Conjugates (9), (5), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Epitopes (11), (7), (6), (6), (3), (1), (1), (1)
Beacon