Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310610

Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KIAA1754L, 1700041B20Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310610
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIAA1754L antibody: synthetic peptide directed towards the C terminal of human KIAA1754L
Sequence EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASR PILTSYHFKT
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against KIAA1754L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KIAA1754L
Background The function remains unknown.
Molecular Weight 61kDa
Gene ID 150771
NCBI Accession NP_001008949, NM_001008949
UniProt Q6GPH6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIAA1754L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives for antigen "Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1)", type "Antibodies"
Hosts (9)
Reactivities (7), (1), (1)
Applications (9), (1)
Epitopes (3), (3), (2), (1), (1)
Beacon