Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1) (C-Term) antibody

Details for Product No. ABIN310610
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms KIAA1754L, 1700041B20Rik
Epitope
C-Term
(3), (2), (2), (1), (1)
Reactivity
Human
(7), (1), (1)
Host
Rabbit
(9)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9)
Pubmed 1 reference available
Catalog no. ABIN310610
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KIAA1754L
Sequence EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASR PILTSYHFKT
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against KIAA1754L. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KIAA1754L
Background The function remains unknown.
Molecular Weight 61 kDa
Gene ID 150771
NCBI Accession NM_001008949, NP_001008949
UniProt Q6GPH6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 555 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1) (C-Term) antibody WB Suggested Anti-KIAA1754L Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Hosts (9)
Reactivities (7), (1), (1)
Applications (9)
Epitopes (3), (2), (2), (1), (1)
back to top