Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody

Details for Product No. ABIN310631
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms rhot1, zgc:55581, zgc:77063, wu:fd14e11, wu:fi14a05, arht2, miro-2, rasl, ARHT1, MIRO-1, MIRO1, 2210403N23Rik, AA415293, AF244542, AI834919, Arht1, C430039G08Rik, Miro1, miro1, si:dkeyp-97g3.6
Epitope
N-Term
(9), (7), (7), (3), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
(24), (2), (2), (2), (2), (2), (1)
Host
Rabbit
(15), (12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(27), (16), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310631
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RHOT1
Sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEI TIPADVTPER
Predicted Reactivity Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against RHOT1. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name RHOT1
Background Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Molecular Weight 71 kDa
Gene ID 55288
NCBI Accession NM_018307, NP_060777
UniProt Q8IXI2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 618 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody anti-Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody
anti-Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody (2) anti-Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody (Image 2)
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Validation Images
back to top