Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310631

Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARHT1, MIRO-1, MIRO1, 2210403N23Rik, AA415293, AF244542, AI834919, Arht1, C430039G08Rik, Miro1, rhot1, zgc:55581, zgc:77063, wu:fd14e11, wu:fi14a05, arht2, miro-2, rasl, miro1, si:dkeyp-97g3.6
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310631
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RHOT1 antibody: synthetic peptide directed towards the N terminal of human RHOT1
Sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEI TIPADVTPER
Predicted Reactivity Chicken : 100%, Guinea pig : 100%, Horse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 92%, Dog : 82%
Characteristics This is a rabbit polyclonal antibody against RHOT1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name RHOT1
Background Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Molecular Weight 71kDa
Gene ID 55288
NCBI Accession NP_060777, NM_018307
UniProt Q8IXI2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RHOT1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives for antigen "Ras Homolog Gene Family, Member T1 (RHOT1)", type "Antibodies"
Hosts (11), (6)
Reactivities (14), (2), (2), (2), (2), (2), (1)
Applications (17), (7), (1), (1), (1)
Epitopes (6), (3), (2), (1), (1), (1), (1)
Beacon