Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310681

Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TLAP, TRAP-BETA, TRAPB, AI315033, AU020133, TRAPbeta, 1500032E05Rik, TRAP[b], TRAPb, wu:fb75b04, zgc:92180, gp25H, MUA22.2, MUA22_2, DDBDRAFT_0206509, DDBDRAFT_0266464, DDB_0206509, DDB_0266464
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310681
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SSR2 antibody: synthetic peptide directed towards the N terminal of human SSR2
Sequence SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQY NIYNVGSSAA
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rat : 100%, Zebrafish : 100%, Chicken : 92%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against SSR2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name SSR2
Background The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2).The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23.
Molecular Weight 20kDa
Gene ID 6746
NCBI Accession NP_003136, NM_003145
UniProt P43308
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SSR2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2)", type "Antibodies"
Hosts (11), (6)
Reactivities (15), (5), (2)
Applications (17), (6), (5), (5), (2), (2), (1)
Epitopes (6), (2), (2), (2), (1), (1), (1)
Beacon