Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8) (C-Term) antibody

Details for Product No. ABIN310736
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CCT8, DKFZp469C2223, MGC89698, C21orf112, Cctq, D21S246, PRED71, AI132397, Tcpq, fa22h09, wu:fa22h09, zgc:56059
Epitope
C-Term
(9), (8), (8), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(37), (17), (5), (4), (3), (2), (1), (1), (1)
Host
Rabbit
(39), (4), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(44), (21), (7), (7), (7), (5), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310736
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CCT8
Sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPA GGPKPPSGKK
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Rabbit : 90 %, African clawed frog : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against CCT8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CCT8
Background As a molecular chaperone, CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Molecular Weight 59 kDa
Gene ID 10694
NCBI Accession NM_006585, NP_006576
UniProt Q5RAP1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 548 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8) (C-Term) antibody WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
anti-Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8) (C-Term) antibody (2) anti-Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8) (C-Term) antibody (Image 2)
anti-Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8) (C-Term) antibody (3) Sample Type: HEK 293 (10ug)
Primary Dilution:
1:1000
Secondary Antibody:
conjugated goat anti-rabbit
Secondary Dilution:
1:10,000
Image Submitted By:
Amy Gray
Brigham Young University
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Validation Images
back to top