Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310736

Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fa22h09, wu:fa22h09, zgc:56059, C21orf112, Cctq, D21S246, PRED71, Tcpq, AI132397, CCT8, DKFZp469C2223, MGC89698
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310736
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCT8 antibody: synthetic peptide directed towards the C terminal of human CCT8
Sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPA GGPKPPSGKK
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 92%, African clawed frog : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against CCT8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCT8
Background As a molecular chaperone, CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Molecular Weight 59kDa
Gene ID 10694
NCBI Accession NP_006576, NM_006585
UniProt Q5RAP1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCT8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8)", type "Antibodies"
Hosts (25), (5), (1)
Reactivities (23), (13), (4), (3), (3), (2), (1), (1), (1)
Applications (31), (11), (5), (4), (3), (3), (3), (1)
Epitopes (6), (5), (2), (2), (2), (1), (1), (1)
Beacon