Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310766

Replication Factor C (Activator 1) 3, 38kDa (RFC3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RFC38, 38kDa, Recc3, AU022547, 2810416I22Rik, cb275, CG5313, DRFC, DmRFC3, Dmel\\CG5313, Rfc3, 21.m02902
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310766
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the N terminal of human RFC3
Sequence YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFK VVLLTEVDKL
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%, African clawed frog : 85%, Bovine : 85%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against RFC3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RFC3
Background The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 38 kD subunit. This subunit is essential for the interaction between the 140 kD subunit and the core complex that consists of the 36, 37, and 40 kD subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Molecular Weight 40kDa
Gene ID 5983
NCBI Accession NP_002906, NM_002915
UniProt P40938
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RFC3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zou, Liu, Elledge: "Replication protein A-mediated recruitment and activation of Rad17 complexes." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 100, Issue 24, pp. 13827-32, 2003 (PubMed).

Alternatives for antigen "Replication Factor C (Activator 1) 3, 38kDa (RFC3)", type "Antibodies"
Hosts (31), (7)
Reactivities (36), (12), (9), (1), (1), (1), (1), (1)
Applications (37), (13), (6), (4), (3), (2), (2), (1), (1)
Epitopes (5), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon