Replication Factor C (Activator 1) 3, 38kDa (RFC3) antibody

Antigen: Replication Factor C (Activator 1) 3, 38kDa (RFC3)

Synonyms: RFC38, MGC5276, CG5313, DmelCG5313, DmRFC3, DRFC, Rfc3, 38kDa, Recc3, AU022547, 2810416I22Rik, cb275, MGC109141, 21.m02902

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN310766

Additional Information

Alternative name: RFC3 / RFC38

Gene ID: RFC3

UniProt: P40938

Immunogen: The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the N terminal of human RFC3

Sequence: YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFK VVLLTEVDKL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RFC3 antibody concentration is 1 mg/ml.

Description: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 38 kD subunit. This subunit is essential for the interaction between the 140 kD subunit and the core complex that consists of the 36, 37, and 40 kD subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Characteristics: Antigen Size: 356 amino acids

Molecular Weight: 40kDa

Application Details

Application Notes: WB Suggested Anti-RFC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RFC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Zou, Liu, Elledge: "Replication protein A-mediated recruitment and activation of Rad17 complexes." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 100, Issue 24, pp. 13827-32, 2003 (PubMed).