Did you know that you can buy products from over 140 different suppliers from us?

Peptidylprolyl Isomerase F (PPIF) (Middle Region) antibody

Details for Product No. ABIN310779
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CYP3, CyP-M, Cyp-D, CypD, CyP-D, CyP-F, PPIase, AW457192, cypf, ppif, wu:fd61c06, zgc:101753
Epitope
Middle Region
(10), (9), (8), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Rat (Rattus), Dog (Canine), Mouse (Murine), Xenopus laevis, Cow (Bovine), Human, Chicken
(60), (23), (22), (11), (11), (11)
Host
Rabbit
(43), (19)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(46), (33), (17), (10), (9), (6), (3), (2)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310779
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PPIF
Sequence GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFT LKHVGPGVLS
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PPIF. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PPIF
Background PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
Molecular Weight 19 kDa
Gene ID 10105
NCBI Accession NM_005729, NP_005720
UniProt P30405
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 207 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Peptidylprolyl Isomerase F (PPIF) (Middle Region) antibody WB Suggested Anti-PPIF Antibody Titration: 5.0ug/ml
Positive Control: 721_B cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

General Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310779
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top