Non-SMC Condensin I Complex, Subunit H (NCAPH) (C-Term) antibody

Details for Product No. ABIN310794
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BRRN1, CAP-H, A730011O11Rik, Brrn1, HCAP-H, mKIAA0074, brrn1, cap-h, NCAPH, si:dkeyp-86b9.4, zgc:158618
Epitope
C-Term
(5), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
(50), (15), (15), (12), (11), (1)
Host
Rabbit
(42), (6), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(40), (22), (9), (5), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN310794
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NCAPH
Sequence TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTE DLSDVLVRQG
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 80 %, Guinea pig : 80 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against NCAPH. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NCAPH
Background NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.
Molecular Weight 82 kDa
Gene ID 23397
NCBI Accession NM_015341, NP_056156
UniProt Q15003
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 741 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Non-SMC Condensin I Complex, Subunit H (NCAPH) (C-Term) antibody WB Suggested Anti-NCAPH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Beausoleil, Villén, Gerber et al.: "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." in: Nature biotechnology, Vol. 24, Issue 10, pp. 1285-92, 2006 (PubMed).

Hosts (42), (6), (5)
Reactivities (50), (15), (15), (12), (11), (1)
Applications (40), (22), (9), (5), (4), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top