Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310800

ASF1 Anti-Silencing Function 1 Homolog B (S. Cerevisiae) (ASF1B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CIA-II, AA409591, 1700003K02Rik, asf1b, fc68a10, wu:fc68a10, zgc:77178, F16F17.110, F16F17_110, SGA01, SGA1, anti- silencing function 1b, ASF1B, asf1, MGC89345
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310800
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ASF1B antibody: synthetic peptide directed towards the middle region of human ASF1B
Sequence YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL ASNPRVTRFH
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Rabbit : 86%
Characteristics This is a rabbit polyclonal antibody against ASF1B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ASF1B
Background ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
Molecular Weight 22kDa
Gene ID 55723
NCBI Accession NP_060624, NM_018154
UniProt Q9NVP2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ASF1B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives for antigen "ASF1 Anti-Silencing Function 1 Homolog B (S. Cerevisiae) (ASF1B)", type "Antibodies"
Hosts (10), (3)
Reactivities (12), (6), (6)
Applications (13), (11), (2), (1)
Epitopes (2), (2), (1)
Beacon