Did you know that you can buy products from over 140 different suppliers from us?

ASF1 Anti-Silencing Function 1 Homolog B (S. Cerevisiae) (ASF1B) (Middle Region) antibody

Details for Product No. ABIN310800
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CIA-II, AA409591, 1700003K02Rik, asf1b, fc68a10, wu:fc68a10, zgc:77178, F16F17.110, F16F17_110, SGA01, SGA1, anti- silencing function 1b, ASF1B, asf1, MGC89345
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(12), (6), (6)
Host
Rabbit
(10), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (10), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310800
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ASF1B
Sequence YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL ASNPRVTRFH
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against ASF1B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ASF1B
Background ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
Molecular Weight 22 kDa
Gene ID 55723
NCBI Accession NM_018154, NP_060624
UniProt Q9NVP2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 202 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ASF1 Anti-Silencing Function 1 Homolog B (S. Cerevisiae) (ASF1B) (Middle Region) antibody WB Suggested Anti-ASF1B Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310800
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top