Did you know that you can buy products from over 140 different suppliers from us?

Lectin, Mannose-Binding 2 (LMAN2) (N-Term) antibody

Details for Product No. ABIN310848
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110003H06Rik, 1300009F09Rik, AA408240, AL023023, AU040819, GP36B, VIP36, Vip36, wu:fb16f04, zgc:158761, C5orf8
Epitope
N-Term
(9), (8), (2)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
(18), (2), (1), (1), (1), (1), (1)
Host
Rabbit
(16), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(18), (9), (2), (2), (2), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310848
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human LMAN2
Sequence SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKE GSIWNHQPCF
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against LMAN2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name LMAN2
Background LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
Molecular Weight 36 kDa
Gene ID 10960
NCBI Accession NM_006816, NP_006807
UniProt Q12907
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 356 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lectin, Mannose-Binding 2 (LMAN2) (N-Term) antibody anti-Lectin, Mannose-Binding 2 (LMAN2) (N-Term) antibody
anti-Lectin, Mannose-Binding 2 (LMAN2) (N-Term) antibody (2) anti-Lectin, Mannose-Binding 2 (LMAN2) (N-Term) antibody (Image 2)
anti-Lectin, Mannose-Binding 2 (LMAN2) (N-Term) antibody (3) anti-Lectin, Mannose-Binding 2 (LMAN2) (N-Term) antibody (Image 3)
Background publications Breuza, Halbeisen, Jenö et al.: "Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46." in: The Journal of biological chemistry, Vol. 279, Issue 45, pp. 47242-53, 2004 (PubMed).

Hosts (16), (5)
Reactivities (18), (2), (1), (1), (1), (1), (1)
Applications (18), (9), (2), (2), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310848
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top