Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310848

Lectin, Mannose-Binding 2 (LMAN2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110003H06Rik, 1300009F09Rik, AA408240, AL023023, AU040819, GP36B, VIP36, Vip36, wu:fb16f04, zgc:158761, C5orf8
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310848
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the N terminal of human LMAN2
Sequence SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKE GSIWNHQPCF
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against LMAN2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name LMAN2
Background LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
Molecular Weight 36kDa
Gene ID 10960
NCBI Accession NP_006807, NM_006816
UniProt Q12907
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LMAN2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Breuza, Halbeisen, Jenö et al.: "Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46." in: The Journal of biological chemistry, Vol. 279, Issue 45, pp. 47242-53, 2004 (PubMed).

Alternatives for antigen "Lectin, Mannose-Binding 2 (LMAN2)", type "Antibodies"
Hosts (11), (4)
Reactivities (12), (2), (1), (1), (1), (1), (1)
Applications (12), (3), (2), (2)
Epitopes (6), (2), (2), (2)
Beacon