Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310961

Nanog Homeobox (NANOG) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ENK, ecat4, 2410002E02Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Pig (Porcine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310961
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NANOG antibody: synthetic peptide directed towards the N terminal of human NANOG
Sequence ESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDL LIQDSPDSST
Predicted Reactivity Bovine : 100%, Human : 100%, Pig : 100%, Sheep : 100%, Dog : 91%
Characteristics This is a rabbit polyclonal antibody against NANOG. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NANOG
Background NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
Molecular Weight 33kDa
Gene ID 79923
NCBI Accession NP_079141, NM_024865
UniProt Q9H9S0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NANOG antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Piestun, Kochupurakkal, Jacob-Hirsch et al.: "Nanog transforms NIH3T3 cells and targets cell-type restricted genes." in: Biochemical and biophysical research communications, Vol. 343, Issue 1, pp. 279-85, 2006 (PubMed).

Alternatives for antigen "Nanog Homeobox (NANOG)", type "Antibodies"
Hosts (101), (38), (14), (3)
Reactivities (132), (39), (19), (15), (3), (2), (1)
Applications (131), (84), (38), (32), (22), (14), (13), (10), (6), (6), (1)
Conjugates (7), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (11), (9), (6), (6), (5), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon