Did you know that you can buy products from over 140 different suppliers from us?

Nanog Homeobox (NANOG) (N-Term) antibody

Details for Product No. ABIN310961
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ENK, ecat4, 2410002E02Rik
Epitope
N-Term
(15), (14), (12), (10), (9), (7), (6), (6), (5), (5), (5), (4), (4), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Pig (Porcine), Cow (Bovine), Human
(159), (43), (20), (14), (3), (1)
Host
Rabbit
(122), (51), (12), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(7), (6), (6), (5), (5), (5), (2), (2), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(147), (102), (40), (34), (31), (23), (18), (16), (10), (5), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310961
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NANOG
Sequence ESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDL LIQDSPDSST
Predicted Reactivity Bovine : 100 %, Human : 100 %, Pig : 100 %, Sheep : 100 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against NANOG. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NANOG
Background NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
Molecular Weight 33 kDa
Gene ID 79923
NCBI Accession NM_024865, NP_079141
UniProt Q9H9S0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 305 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nanog Homeobox (NANOG) (N-Term) antibody WB Suggested Anti-NANOG Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Piestun, Kochupurakkal, Jacob-Hirsch et al.: "Nanog transforms NIH3T3 cells and targets cell-type restricted genes." in: Biochemical and biophysical research communications, Vol. 343, Issue 1, pp. 279-85, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310961
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top