UDP-Glucose Pyrophosphorylase 2 (UGP2) (N-Term) antibody

Details for Product No. ABIN311020
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms UDPG, UDPGP, UDPGP2, UGP1, UGPP1, UGPP2, pHC379, Ugp2, fi53h10, wu:fi53h10, zgc:85662, si:ch73-233a22.2, DDBDRAFT_0204359, DDBDRAFT_0214911, DDB_0204359, DDB_0214911
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Pig (Porcine), Dog (Canine), Human, Chicken
(24), (15), (13), (13), (12), (12), (12), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(26), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (10), (4), (4), (4), (3), (2), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN311020
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human UGP2
Sequence TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYE KIKARGLPDN
Predicted Reactivity African clawed frog : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against UGP2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UGP2
Background UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen, in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen, in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 56 kDa
Gene ID 7360
NCBI Accession NM_001001521, NP_001001521
UniProt Q16851-2
Research Area Cancer, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 497 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-UDP-Glucose Pyrophosphorylase 2 (UGP2) (N-Term) antibody WB Suggested Anti-UGP2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (26), (2)
Reactivities (24), (15), (13), (13), (12), (12), (12), (1), (1), (1), (1), (1), (1), (1)
Applications (19), (10), (10), (4), (4), (4), (3), (2), (2), (2), (2), (1)
Conjugates (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
back to top