Chromosome 1 Open Reading Frame 63 (C1orf63) (C-Term) antibody

Details for Product No. ABIN311029
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms NPD014, DJ465N24.2.1, RP3-465N24.4, DKFZp469M2120
Epitope
C-Term
(1), (1)
Reactivity
Human
(15), (12), (12)
Host
Rabbit
(15), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN311029
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human C1orf63
Sequence PTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQK KSPYGLWIPI
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against C1orf63. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C1orf63
Background The exact function of C1orf63 remains unknown.
Molecular Weight 33 kDa
Gene ID 57035
NCBI Accession NM_020317, NP_064713
UniProt Q9BUV0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 290 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 1 Open Reading Frame 63 (C1orf63) (C-Term) antibody WB Suggested Anti-C1orf63 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Hosts (15), (1)
Reactivities (15), (12), (12)
Applications (10), (7), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
back to top