Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311029

Chromosome 1 Open Reading Frame 63 (C1orf63) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NPD014, DJ465N24.2.1, RP3-465N24.4, DKFZp469M2120
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311029
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C1orf63 antibody: synthetic peptide directed towards the C terminal of human C1orf63
Sequence PTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQK KSPYGLWIPI
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C1orf63. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C1orf63
Background The exact function of C1orf63 remains unknown.
Molecular Weight 33kDa
Gene ID 57035
NCBI Accession NP_064713, NM_020317
UniProt Q9BUV0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C1orf63 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Chromosome 1 Open Reading Frame 63 (C1orf63)", type "Antibodies"
Hosts (16)
Reactivities (15), (12), (12)
Applications (10), (7), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Beacon