Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311037

Chromosome 19 Open Reading Frame 47 (C19orf47) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC79696
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311037
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C19orf47 antibody: synthetic peptide directed towards the C terminal of human C19orf47
Sequence DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMD HAGTVSVFKR
Predicted Reactivity Guinea pig : 100%, Dog : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against C19orf47. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C19orf47
Background The function remains unknown.
Molecular Weight 38kDa
Gene ID 126526
NCBI Accession NP_849152, NM_178830
UniProt Q8N9M1-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C19orf47 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Chromosome 19 Open Reading Frame 47 (C19orf47)", type "Antibodies"
Hosts (17)
Reactivities (15), (13), (13), (13), (12), (12), (1), (1)
Applications (10), (8), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Beacon