Did you know that you can buy products from over 140 different suppliers from us?

Tetratricopeptide Repeat Domain 6 (TTC6) (C-Term) antibody

Details for Product No. ABIN311044
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EG639426, ENSMUSG00000046782, Gm69, Gm9813, C14orf25, NCRNA00291, MGC119358, MGC119360, MGC119361
Epitope
C-Term
(8), (8)
Reactivity
Mouse (Murine), Dog (Canine), Human
(9)
Host
Rabbit
(10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311044
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TTC6
Sequence MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSK ALKFDPENEY
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against TTC6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TTC6
Background The functions of TTC6 remain unknown.
Molecular Weight 59 kDa
Gene ID 115669
NCBI Accession NM_001007795, NP_001007796
UniProt Q86TZ1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 520 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tetratricopeptide Repeat Domain 6 (TTC6) (C-Term) antibody WB Suggested Anti-TTC6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311044
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top