Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311044

Tetratricopeptide Repeat Domain 6 (TTC6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EG639426, ENSMUSG00000046782, Gm69, Gm9813, C14orf25, NCRNA00291, MGC119358, MGC119360, MGC119361
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN311044
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TTC6 antibody: synthetic peptide directed towards the C terminal of human TTC6
Sequence MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSK ALKFDPENEY
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against TTC6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TTC6
Background The functions of TTC6 remain unknown.
Molecular Weight 59kDa
Gene ID 115669
NCBI Accession NP_001007796, NM_001007795
UniProt Q86TZ1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TTC6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Alternatives for antigen "Tetratricopeptide Repeat Domain 6 (TTC6)", type "Antibodies"
Hosts (6)
Reactivities (5)
Applications (6), (2)
Epitopes (5), (2), (2)
Beacon