Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311050

tRNA Methyltransferase 11 Homolog (S. Cerevisiae) (Trmt11) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Mds024, MDS024, C6orf75, TRM11, TRMT11-1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311050
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11
Sequence IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVF SVLEDYGLDP
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Pig : 92%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against TRMT11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRMT11
Background TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.
Molecular Weight 53kDa
Gene ID 60487
NCBI Accession NP_001026882, NM_001031712
UniProt Q7Z4G4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRMT11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Alternatives for antigen "tRNA Methyltransferase 11 Homolog (S. Cerevisiae) (Trmt11)", type "Antibodies"
Hosts (5), (1)
Reactivities (5)
Applications (6), (3), (1), (1)
Epitopes (3), (2), (1), (1), (1)
Beacon