Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311064

Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MAPKKK1, MEKK, MEKK 1, MEKK1, SRXY6, Mekk, Mekk1, MAP3K1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311064
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1
Sequence LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEA LREEIRMMSH
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against MAP3K1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAP3K1
Background MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.
Molecular Weight 164kDa
Gene ID 4214
NCBI Accession NP_005912, NM_005921
UniProt Q13233
Research Area Kinases/Phosphatases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAP3K1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Hancock, Beckly, Geremia et al.: "Clinical and molecular characteristics of isolated colonic Crohn's disease." in: Inflammatory bowel diseases, Vol. 14, Issue 12, pp. 1667-77, 2008 (PubMed).

Alternatives for antigen "Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1)", type "Antibodies"
Hosts (40), (3)
Reactivities (39), (20), (18)
Applications (33), (25), (13), (12), (4), (3), (1), (1), (1)
Epitopes (12), (8), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon