Did you know that you can buy products from over 140 different suppliers from us?

Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1) (C-Term) antibody

Details for Product No. ABIN311064
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MAPKKK1, MEKK, MEKK 1, MEKK1, SRXY6, Mekk, Mekk1, MAP3K1
Epitope
C-Term
(18), (10), (10), (6), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(52), (24), (16)
Host
Rabbit
(59), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2)
Application
Western Blotting (WB)
(45), (43), (17), (11), (10), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311064
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MAP3K1
Sequence LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEA LREEIRMMSH
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against MAP3K1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MAP3K1
Background MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.
Molecular Weight 164 kDa
Gene ID 4214
NCBI Accession NM_005921, NP_005912
UniProt Q13233
Research Area Kinases/Phosphatases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1512 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1) (C-Term) antibody WB Suggested Anti-MAP3K1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
General Hancock, Beckly, Geremia et al.: "Clinical and molecular characteristics of isolated colonic Crohn's disease." in: Inflammatory bowel diseases, Vol. 14, Issue 12, pp. 1667-77, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311064
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top