Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13) antibody

Antigen: Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13)

Synonyms: zC146F4.4

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN311080

Additional Information

Alternative name: NUDT13

Gene ID: NUDT13

UniProt: Q86X67

Immunogen: The immunogen for anti-NUDT13 antibody: synthetic peptide directed towards the N terminal of human NUDT13

Sequence: MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDAC KKAQQTGAFY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NUDT13 antibody concentration is 1 mg/ml.

Description: NUDT13 contains 1 nudix hydrolase domain. The exact function of NUDT13 remains unknown.

Characteristics: Antigen Size: 352 amino acids

Molecular Weight: 40kDa

Application Details

Application Notes: WB Suggested Anti-NUDT13 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NUDT13 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).