Did you know that you can buy products from over 140 different suppliers from us?

Methyltransferase Like 2B (METTL2B) (N-Term) antibody

Details for Product No. ABIN311090
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms METTL2B, METL, METTL2, METTL2A, PSENIP1, Mettl2
Epitope
N-Term
(11), (9), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(16), (1), (1), (1), (1), (1)
Host
Rabbit
(16), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (7), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311090
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human METTL2B
Sequence INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNH LKDWFLENKS
Predicted Reactivity Dog :100 %,   Human :100 %,   Bovine :90 %,   Mouse :70 %,   Rat :70 %,  
Characteristics This is a rabbit polyclonal antibody against METTL2B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name METTL2B
Background METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.
Molecular Weight 43 kDa
Gene ID 55798
NCBI Accession NM_018396, NP_060866
UniProt Q6P1Q9
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 378 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Methyltransferase Like 2B (METTL2B) (N-Term) antibody WB Suggested Anti-METTL2B Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Zody, Garber, Adams et al.: "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." in: Nature, Vol. 440, Issue 7087, pp. 1045-9, 2006 (PubMed).

Validation Images
back to top