Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311090

Methyltransferase Like 2B (METTL2B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms METL, METTL2, METTL2A, PSENIP1, METTL2B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311090
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B
Sequence INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNH LKDWFLENKS
Predicted Reactivity Dog :100%,   Human :100%,   Bovine :91%,   Mouse :75%,   Rat :75%,  
Characteristics This is a rabbit polyclonal antibody against METTL2B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name METTL2B
Background METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.
Molecular Weight 43kDa
Gene ID 55798
NCBI Accession NP_060866, NM_018396
UniProt Q6P1Q9
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-METTL2B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zody, Garber, Adams et al.: "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." in: Nature, Vol. 440, Issue 7087, pp. 1045-9, 2006 (PubMed).

Alternatives for antigen "Methyltransferase Like 2B (METTL2B)", type "Antibodies"
Hosts (10), (2)
Reactivities (10), (1), (1), (1), (1), (1)
Applications (12), (3), (2), (1), (1), (1)
Epitopes (6), (3), (1), (1), (1), (1)
Beacon