Did you know that you can buy products from over 140 different suppliers from us?

PDZ Binding Kinase (PBK) (N-Term) antibody

Details for Product No. ABIN311092
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms topk, zgc:92050, CT84, Nori-3, SPK, TOPK, AW538537, D14Ertd732e, 2810434B10Rik, PBK
Epitope
N-Term
(18), (12), (11), (7), (6), (6), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Human
(102), (31), (27), (12), (12), (12)
Host
Rabbit
(74), (30)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(73), (62), (28), (20), (17), (16), (7), (5), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311092
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PBK
Sequence SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALN MARGLKYLHQ
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Dog : 100 %, Human : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against PBK. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PBK
Background PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.
Molecular Weight 36 kDa
Gene ID 55872
NCBI Accession NM_018492, NP_060962
UniProt Q96KB5
Research Area Cancer, Cell Cycle, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 322 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PDZ Binding Kinase (PBK) (N-Term) antibody WB Suggested Anti-PBK Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Hosts (74), (30)
Reactivities (102), (31), (27), (12), (12), (12)
Applications (73), (62), (28), (20), (17), (16), (7), (5), (3), (3), (2), (1)
Conjugates (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (18), (12), (11), (7), (6), (6), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311092
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top